Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018447 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018447, RRID:AB_1853867
- Product name
- Anti-HSCB
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKE
FTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIK
LKK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1.
Ferecatu I, Gonçalves S, Golinelli-Cohen MP, Clémancey M, Martelli A, Riquier S, Guittet E, Latour JM, Puccio H, Drapier JC, Lescop E, Bouton C
The Journal of biological chemistry 2014 Oct 10;289(41):28070-86
The Journal of biological chemistry 2014 Oct 10;289(41):28070-86
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN