HPA005835

antibody from Atlas Antibodies

Targeting: ECH1 HPXEL

Western blot

Antibody data

Submit

Validation data

Product number: HPA005835 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA005835, RRID:AB_1847965
Product name: Anti-ECH1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARK MMADEALGSGLVSRVFPDKEVMLDAALALAAEISS KSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSM LQTQDLVKSVQATTENKELKTVTF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ECH1 protein structure - HPA005835 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in a granular pattern in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse olfactory bulb shows positivity in the mitral cell layer.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse caudate putamen shows positivity in neurons and blood vessels.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse hippocampus shows immunoreactivity in the CA1 region.
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cell bodies.
Sample type: HUMAN