Explore
Validate
LearnPAB28534
antibody from Abnova Corporation
Targeting: ILF3
DRBP76, MPHOSPH4, MPP4, MPP4110, NF110, NF110b, NF90, NF90a, NF90c, NF90ctv, NFAR-1, NFAR-2, NFAR110, NFAR90, TCP110
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28534 - Provider product page
- Provider
- Abnova Corporation
- Product name
- ILF3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ILF3.
- Antigen sequence
VMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDW
IDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTE
HMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKE
KPTTALLDKVADNLAIQLAAVTEDKYEILQSVDDA
AIVIK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with ILF3 polyclonal antibody (Cat # PAB28534) at 1:100-1:250 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with ILF3 polyclonal antibody (Cat # PAB28534) at 1:100-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251MG with ILF3 polyclonal antibody (Cat # PAB28534) at 1-4 ug/ml shows positivity in nucleus and mitochondria.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate with ILF3 polyclonal antibody (Cat # PAB28534) shows strong nuclear positivity in glandular cells at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
