HPA029397

antibody from Atlas Antibodies

Targeting: IL32 NK4, TAIF, TAIFb, TAIFd

Antibody data

Submit

Validation data

Product number: HPA029397 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029397, RRID:AB_10612120
Product name: Anti-IL32
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRG QVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPL LEKERDGLRCR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IL32 protein structure - HPA029397 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in subsets of lymphoid cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong cytoplasmic positivity in Langerhans cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in non - germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in non - germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gastrointestinal shows moderate to strong cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN