HPA001911

antibody from Atlas Antibodies

Targeting: FARSA CML33, FARSL, FARSLA

Western blot

Antibody data

Submit

Validation data

Product number: HPA001911 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001911, RRID:AB_1848427
Product name: Anti-FARSA
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EVIEAELRSTKHWELTAEGEEIAREGSHEARVFRS IPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKS AADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGE KERSELRKRKLLAEVTLKTYWVSKG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FARSA protein structure - HPA001911 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA001911 antibody. Corresponding FARSA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows very strong cytoplasmic positivity in neurons.
Sample type: HUMAN