Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183891 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Arginine Methyltransferase 2 (PRMT2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRMT2 antibody: synthetic peptide directed towards the N terminal of human PRMT2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATD
ETQLS FLRGEKILIL- Vial size
- 0.1 mg
Submitted references Single-cell profiling of epigenetic modifiers identifies PRDM14 as an inducer of cell fate in the mammalian embryo.
Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma.
Identification and expression analysis of a novel transcript of the human PRMT2 gene resulted from alternative polyadenylation in breast cancer.
Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
Burton A, Muller J, Tu S, Padilla-Longoria P, Guccione E, Torres-Padilla ME
Cell reports 2013 Nov 14;5(3):687-701
Cell reports 2013 Nov 14;5(3):687-701
Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma.
Zhong J, Cao RX, Zu XY, Hong T, Yang J, Liu L, Xiao XH, Ding WJ, Zhao Q, Liu JH, Wen GB
The FEBS journal 2012 Jan;279(2):316-35
The FEBS journal 2012 Jan;279(2):316-35
Identification and expression analysis of a novel transcript of the human PRMT2 gene resulted from alternative polyadenylation in breast cancer.
Zhong J, Cao RX, Hong T, Yang J, Zu XY, Xiao XH, Liu JH, Wen GB
Gene 2011 Nov 1;487(1):1-9
Gene 2011 Nov 1;487(1):1-9
Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
Qi C, Chang J, Zhu Y, Yeldandi AV, Rao SM, Zhu YJ
The Journal of biological chemistry 2002 Aug 9;277(32):28624-30
The Journal of biological chemistry 2002 Aug 9;277(32):28624-30
No comments: Submit comment
No validations: Submit validation data