AV45219

GZMK antibody from Sigma-Aldrich
PRSS, TRYP2
No application information provided.

Antibody data

Product number
AV45219
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV45219, RRID:AB_1849966
Product name
Anti-GZMK antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV45219
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GZMK with an internal ID of P26210
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFS
RVTSDPQSNDIMLVK
Storage
-20C
Provider Type Product Number
- No reagents -