H00005682-M01

PSMA1 antibody from Abnova Corporation
HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30

Antibody data

Product number
H00005682-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005682-M01, RRID:AB_425626
Product name
PSMA1 monoclonal antibody (M01), clone 1D9-1C7
Provider product page
Abnova Corporation - H00005682-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant PSMA1.
Antigen sequence
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSAT
VGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHI
GISIAGLTADARLLCNFMRQECLDSRFVFDRPLPV
SRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDM
GPHIFQTCPSANYFDCRAMSIGARSQSARTYLERH
MSEFMECNLNELVKHGLRALRETLPAEQDLTTKNV
SIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQ
PAQPADEPAEKADEPMEH
Isotype
IgG
Antibody clone number
1D9-1C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -