PAB23941

PLP2 antibody from Abnova Corporation
A4, A4-LSB, MGC126187

Antibody data

Product number
PAB23941
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23941, RRID:AB_11122766
Product name
PLP2 polyclonal antibody
Provider product page
Abnova Corporation - PAB23941
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant PLP2.
Antigen sequence
RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -