ABIN310671

PLP2 antibody from antibodies-online
A4, A4-LSB, MGC126187

Antibody data

Product number
ABIN310671
Provider
antibodies-online
Product name
anti-Proteolipid Protein 2 (PLP2) antibody
Provider product page
antibodies-online - ABIN310671
Antibody type
Polyclonal
Antigen
The immunogen for anti-PLP2 antibody: synthetic peptide directed towards the middle region of human PLP2
Reactivity
Human, Mouse, Rat, Bovine, Canine, Rabbit
Host
Rabbit
Antigen sequence
LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQ
PRHTA APTDPADGPV
Vial size
0.1 mg
Provider Type Product Number
- No reagents -