AV45348

PLP2 antibody from MilliporeSigma / Merck KGaA
A4, A4-LSB, MGC126187
No application information provided.

Antibody data

Product number
AV45348
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV45348, RRID:AB_1855475
Product name
Anti-PLP2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV45348
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PLP2 with an internal ID of P26324
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQ
PRHTAAPTDPADGPV
Storage
-20C
Provider Type Product Number
- No reagents -