HPA055599

HEY1 antibody from Atlas Antibodies
bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA055599
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055599, RRID:AB_2682858
Product name
Anti-HEY1
Provider product page
Atlas Antibodies - HPA055599
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIA
HPLLLPQNGHGNAGTTASPTEPHHQG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -