R32081

SOX5 antibody from NSJ Bioreagents
L-SOX5, MGC35153

Antibody data

Product number
R32081
Provider
NSJ Bioreagents
Product name
SOX5 Antibody
Provider product page
NSJ Bioreagents - R32081
Antibody type
Polyclonal
Antigen
Amino acids EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS of human SOX5 were used as the immunogen for the SOX5 antibody.
Description
Antigen affinity
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the SOX5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -