AV33323

SOX5 antibody from Sigma-Aldrich
L-SOX5, MGC35153
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV33323
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV33323, RRID:AB_1857387
Product name
Anti-SOX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV33323
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SOX5 with an internal ID of P04365
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGMPSPHLPSEHSSVSSSPEPGMPVIQSTYGVKGE
EPHIKEEIQAEDING
Storage
-20C
Provider Type Product Number
- No reagents -