HPA017876

antibody from Atlas Antibodies

Targeting: KTN1 CG1, KIAA0004, KNT

Antibody data

Submit

Validation data

Product number: HPA017876 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017876, RRID:AB_1852652
Product name: Anti-KTN1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKS QIEQLKQQNYQQASSFPPHEELLKVISEREKEISG LWNELDSLKDAVEHQRKKNNERQQQVEAVELEAKE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KTN1 protein structure - HPA017876 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, lymph node, skin and testis using Anti-KTN1 antibody HPA017876 (A) shows similar protein distribution across tissues to independent antibody HPA003178 (B).
Antibody #2 product nr: HPA003178
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-KTN1 antibody HPA017876.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-KTN1 antibody HPA017876.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-KTN1 antibody HPA017876.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-KTN1 antibody HPA017876.
Sample type: HUMAN