HPA023160

antibody from Atlas Antibodies

Targeting: DECR1 DECR, SDR18C1

Antibody data

Submit

Validation data

Product number: HPA023160 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023160, RRID:AB_1847585
Product name: Anti-DECR1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVP SASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIK TKGAFSRLDP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DECR1 protein structure - HPA023160 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and placenta tissues using HPA023160 antibody. Corresponding DECR1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, lymph node and placenta using Anti-DECR1 antibody HPA023160 (A) shows similar protein distribution across tissues to independent antibody HPA023162 (B).
Antibody #2 product nr: HPA023162, HPA023238
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows moderate to strong granular cytoplasmic positivity in cardiomyocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-DECR1 antibody HPA023160.
Sample type: HUMAN