Antibody data

Product number
PAB20248
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20248, RRID:AB_10968128
Product name
ITPR3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20248
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ITPR3.
Antigen sequence
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNL
MMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMND
LGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLG
PSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLL
CENHNRD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -