AMAb91226

GRHL2 antibody from Atlas Antibodies
BOM, DFNA28, FLJ13782, TFCP2L3

Antibody data

Product number
AMAb91226
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#AMAb91226, RRID:AB_2665852
Product name
Anti-GRHL2
Provider product page
Atlas Antibodies - AMAb91226
Antibody type
Monoclonal
Reactivity
Human
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPES
SAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEE
QRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTY
SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYT
LEATKSLRQK
Epitope
Binds to an epitope located within the peptide sequence VVKAEDFTPV as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL3760
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -