H00008667-M16

EIF3H antibody from Abnova Corporation
eIF3-gamma, eIF3-p40, eIF3h, EIF3S3

Antibody data

Product number
H00008667-M16
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008667-M16, RRID:AB_1136926
Product name
EIF3S3 monoclonal antibody (M16), clone 3C6
Provider product page
Abnova Corporation - H00008667-M16
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EIF3S3.
Antigen sequence
MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSA
VKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGL
VVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMR
SLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSY
QHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLME
VCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHL
INVLMWELEKKSAVADKHELLSLASSNHLGKNLQL
LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQR
RQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMD
SLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEY
NN
Isotype
IgG
Antibody clone number
3C6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -