H00022859-D01P

ADGRL1 antibody from Abnova Corporation
CIRL1, KIAA0821, LEC2, LPHN1

Antibody data

Product number
H00022859-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022859-D01P, RRID:AB_10720703
Product name
LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00022859-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human LPHN1 protein.
Antigen sequence
MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNG
KAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSG
HPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLS
GQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLH
LCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFV
GLRGRGSRKELGGRGQVGGWRDPFCC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.