HPA015791

antibody from Atlas Antibodies

Targeting: SALL4 dJ1112F19.1, ZNF797

Antibody data

Submit

Validation data

Product number: HPA015791 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015791, RRID:AB_1856547
Product name: Anti-SALL4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKA GSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFT LKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFS TVALDTSKKGKGKPPNISAVDVKPKDE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SALL4 protein structure - HPA015791 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA015791 antibody. Corresponding SALL4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, lymph node, ovary and testis using Anti-SALL4 antibody HPA015791 (A) shows similar protein distribution across tissues to independent antibody HPA015291 (B).
Antibody #2 product nr: HPA015291
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human ovary shows moderate nuclear positivity in follicle cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in a subset of cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows no positivity in germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human ovary shows weak nuclear positivity in follicle cells.
Sample type: HUMAN