HPA028285

antibody from Atlas Antibodies

Targeting: RBKS DKFZp686G13268, RBSK

Antibody data

Submit

Validation data

Product number: HPA028285 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA028285, RRID:AB_10601480
Product name: Anti-RBKS
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LNTEDLRAAANVISRAKVMVCQLEITPATSLEALT MARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNE SEAEILTGLTVGSAADAGEAALVLLK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RBKS protein structure - HPA028285 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and cerebral cortex tissues using Anti-RBKS antibody. Corresponding RBKS RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, cerebral cortex, liver and testis using Anti-RBKS antibody HPA028285 (A) shows similar protein distribution across tissues to independent antibody HPA019725 (B).
Antibody #2 product nr: HPA019725
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-RBKS antibody HPA028285.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-RBKS antibody HPA028285.
Sample type: HUMAN