Antibody data

Product number
H00008030-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008030-M03, RRID:AB_529979
Product name
CCDC6 monoclonal antibody (M03), clone 5D11
Provider product page
Abnova Corporation - H00008030-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CCDC6.
Antigen sequence
HTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGI
TRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPP
PPPPMQPTVPSAATSQPTPSQHSAHPSSQP
Isotype
IgG
Antibody clone number
5D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -