HPA017913

antibody from Atlas Antibodies

Targeting: COL15A1

Antibody data

Submit

Validation data

Product number: HPA017913 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017913, RRID:AB_1847099
Product name: Anti-COL15A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLT VHPDPRTPEELCDPEESSASGETSGLQEADGVAEI LEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELS GEPVPE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

COL15A1 protein structure - HPA017913 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and liver tissues using Anti-COL15A1 antibody. Corresponding COL15A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, placenta and testis using Anti-COL15A1 antibody HPA017913 (A) shows similar protein distribution across tissues to independent antibody HPA017915 (B).
Antibody #2 product nr: HPA017915
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows distinct positivity of collagen fibers and endothelial cells in the stroma.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-COL15A1 antibody HPA017913.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-COL15A1 antibody HPA017913.
Sample type: HUMAN