Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002927 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002927, RRID:AB_1078744
- Product name
- Anti-ENTPD5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPG
LSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTP
VVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLV
PKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQET
VGTL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo.
Horak P, Tomasich E, Vaňhara P, Kratochvílová K, Anees M, Marhold M, Lemberger CE, Gerschpacher M, Horvat R, Sibilia M, Pils D, Krainer M
Scientific reports 2014 Jan 17;4:3739
Scientific reports 2014 Jan 17;4:3739
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and skeletal muscle tissues using Anti-ENTPD5 antibody. Corresponding ENTPD5 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN