HPA004886

antibody from Atlas Antibodies

Targeting: FLNB ABP-278, FH1, FLN1L, LRS1, TABP, TAP

Antibody data

Submit

Validation data

Product number: HPA004886 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004886, RRID:AB_1848600
Product name: Anti-FLNB
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAE VSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVP HFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT DFTV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FLNB protein structure - HPA004886 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, pancreas and testis using Anti-FLNB antibody HPA004886 (A) shows similar protein distribution across tissues to independent antibody HPA004747 (B).
Antibody #2 product nr: HPA004747
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-FLNB antibody HPA004886.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-FLNB antibody HPA004886.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-FLNB antibody HPA004886.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-FLNB antibody HPA004886.
Sample type: HUMAN