H00010518-A01

CIB2 antibody from Abnova Corporation
DFNB48, KIP2, USH1J
No application information provided.

Antibody data

Product number
H00010518-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010518-A01, RRID:AB_489656
Product name
CIB2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00010518-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant CIB2.
Antigen sequence
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFY
ELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPF
KERIVAAFSEDGEGNLTFNDFVDMFSVLC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -