PAB23026

MATR3 antibody from Abnova Corporation
KIAA0723, MGC9105, MPD2, VCPDM

Antibody data

Product number
PAB23026
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23026, RRID:AB_11122351
Product name
MATR3 polyclonal antibody
Provider product page
Abnova Corporation - PAB23026
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MATR3.
Antigen sequence
VVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNK
INEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRV
HLSQKYKRIKKPEGKPDQKF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.