HPA064307

antibody from Atlas Antibodies

Targeting: BLMH BH

Antibody data

Submit

Validation data

Product number: HPA064307 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA064307, RRID:AB_2685241
Product name: Anti-BLMH
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNK LYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIK DGEAVWFGCDVGK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BLMH protein structure - HPA064307 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skin and liver tissues using Anti-BLMH antibody. Corresponding BLMH RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, skin and testis using Anti-BLMH antibody HPA064307 (A) shows similar protein distribution across tissues to independent antibody HPA039548 (B).
Antibody #2 product nr: HPA039548
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-BLMH antibody HPA064307.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-BLMH antibody HPA064307.
Sample type: HUMAN