ABIN311140

EOGT antibody from antibodies-online
AER61, C3orf64, FLJ33770

Antibody data

Product number
ABIN311140
Provider
antibodies-online
Product name
anti-Chromosome 3 Open Reading Frame 64 (C3orf64) (C-Term) antibody
Provider product page
antibodies-online - ABIN311140
Antibody type
Polyclonal
Antigen
The immunogen for anti-C3orf64 antibody: synthetic peptide directed towards the C terminal of human C3orf64
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQ
HPKWP FKKKHDEL
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -