AV49111

EOGT antibody from MilliporeSigma / Merck KGaA
AER61, C3orf64, FLJ33770
No application information provided.

Antibody data

Product number
AV49111
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV49111, RRID:AB_1844627
Product name
Anti-C3ORF64 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV49111
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human C3orf64 with an internal ID of Y02309
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQ
HPKWPFKKKHDEL
Storage
-20C
Provider Type Product Number
- No reagents -