HPA012501

antibody from Atlas Antibodies

Targeting: LPCAT1 AGPAT10, AGPAT9, AYTL2, FLJ12443

Antibody data

Submit

Validation data

Product number: HPA012501 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012501, RRID:AB_1845224
Product name: Anti-LPCAT1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPI WGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSN GKWPQIMIFPEGTCTNRTC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LPCAT1 protein structure - HPA012501 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and liver tissues using HPA012501 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody HPA012501 (A) shows similar protein distribution across tissues to independent antibody HPA022268 (B).
Antibody #2 product nr: HPA022268
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Sample type: HUMAN