SAB1401706

ASB2 antibody from MilliporeSigma / Merck KGaA
ASB-2
ELISA
Recommended by provider

Antibody data

Product number
SAB1401706
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-ASB2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401706
Antibody type
Monoclonal
Antigen
ASB2 (AAH32354, 1 a.a. ~ 588 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPM
GSFQGVMQKYSSSLFKTSQLAPADPLIKAIKDGDE
EALKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGC
LKVLQRAYPGTIDQRTLQEETAVYLATCRGHLDCL
LSLLQAGAEPDISNKSRETPLYKACERKNAEAVKI
LVQHNADTNHRCNRGWTALHESVSRNDLEVMQILV
SGGAKVESKNAYGITPLFVAAQSGQLEALRFLAKY
GADINTQASD
Isotype
IgG
Storage
-20C