Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406079 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Metallophosphoesterase 1 (MPPE1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MPPE1 antibody: synthetic peptide directed towards the N terminal of human MPPE1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQK
MFRHP SHVQLKVVAG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Lineage-specific gene duplication and loss in human and great ape evolution.
Fortna A, Kim Y, MacLaren E, Marshall K, Hahn G, Meltesen L, Brenton M, Hink R, Burgers S, Hernandez-Boussard T, Karimpour-Fard A, Glueck D, McGavran L, Berry R, Pollack J, Sikela JM
PLoS biology 2004 Jul;2(7):E207
PLoS biology 2004 Jul;2(7):E207
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting