Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29485 - Provider product page
- Provider
- Abnova Corporation
- Product name
- TNFRSF14 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.
- Antigen sequence
PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAP
ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTG
TVCEPCPPGTYIAHLNGLSKCLQCQMCD- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot (Cell lysate) analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp cell lysate with TNFRSF14 polyclonal antibody (Cat# PAB29485) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of U-2 OS cells with TNFRSF14 polyclonal antibody (Cat# PAB29485) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with TNFRSF14 polyclonal antibody (Cat# PAB29485) shows strong cytoplasmic positivity in glandular cells at 1:20 - 1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)