HPA031461

NR6A1 antibody from Atlas Antibodies
CT150, GCNF, GCNF1, RTR

Antibody data

Product number
HPA031461
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031461, RRID:AB_2673894
Product name
Anti-NR6A1
Provider product page
Atlas Antibodies - HPA031461
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LILLSSLTVYSKQIFGELADVTAKYSPSDEELHRF
SDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAIN
FLNQDIRGLTSASQLEQLNKRYWYICQDFTE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -