HPA026542

antibody from Atlas Antibodies

Targeting: ACADM ACAD1, MCAD, MCADH

Antibody data

Submit

Validation data

Product number: HPA026542 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026542, RRID:AB_1844469
Product name: Anti-ACADM
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIV FEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAA GAVGLAQRALDEATKYALERKTFGKLLVEHQAISF MLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASI AKAFAGDIA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ACADM protein structure - HPA026542 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skin tissues using HPA026542 antibody. Corresponding ACADM RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, lymph node and skin using Anti-ACADM antibody HPA026542 (A) shows similar protein distribution across tissues to independent antibody HPA006198 (B).
Antibody #2 product nr: HPA006198
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong to very strong positivity in cytoplasm granular in hepatocytes.
Sample type: HUMAN