Antibody data

Product number
H00055697-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055697-M03, RRID:AB_1707979
Product name
VAC14 monoclonal antibody (M03), clone 3B2
Provider product page
Abnova Corporation - H00055697-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant VAC14.
Antigen sequence
SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDY
AELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Isotype
IgG
Antibody clone number
3B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -