HPA001426

antibody from Atlas Antibodies

Targeting: LGMN LGMN1, PRSC1

Antibody data

Submit

Validation data

Product number: HPA001426 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001426, RRID:AB_1079247
Product name: Anti-LGMN
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRK LMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIV SLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRT HCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKL SMDHVCLGHY
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LGMN protein structure - HPA001426 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-LGMN antibody. Corresponding LGMN RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong granular cytoplasmic positivity in non-germinal center cells.
Sample type: HUMAN