WH0002300M3

FOXL1 antibody from Sigma-Aldrich
FKH6, FKHL11, FREAC7
ELISA
Recommended by provider

Antibody data

Product number
WH0002300M3
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0002300M3, RRID:AB_1841672
Product name
Monoclonal Anti-FOXL1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0002300M3
Antibody type
Monoclonal
Antigen
FOXL1 (NP_005241, a.a. 132-240) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSA
EAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPS
PPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAART
GDGP (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -