H00002300-M04

FOXL1 antibody from Abnova Corporation
FKH6, FKHL11, FREAC7

Antibody data

Product number
H00002300-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002300-M04, RRID:AB_875588
Product name
FOXL1 monoclonal antibody (M04), clone 1C3
Provider product page
Abnova Corporation - H00002300-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant FOXL1.
Antigen sequence
MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSA
EAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPS
PPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAART
GDGP
Isotype
IgG
Antibody clone number
1C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -