Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007415 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007415, RRID:AB_1080602
- Product name
- Anti-WWTR1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS
GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGS
PAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR
YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Role of the YAP Oncoprotein in Priming Ras-Driven Rhabdomyosarcoma.
Metabolic control of YAP and TAZ by the mevalonate pathway
Slemmons KK, Crose LE, Rudzinski E, Bentley RC, Linardic CM
PloS one 2015;10(10):e0140781
PloS one 2015;10(10):e0140781
Metabolic control of YAP and TAZ by the mevalonate pathway
Sorrentino G, Ruggeri N, Specchia V, Cordenonsi M, Mano M, Dupont S, Manfrin A, Ingallina E, Sommaggio R, Piazza S, Rosato A, Piccolo S, Del Sal G
Nature Cell Biology 2014 March;16(4):357-366
Nature Cell Biology 2014 March;16(4):357-366
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-WWTR1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA007415 antibody. Corresponding WWTR1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate nuclear positivity in glomerular cells and a subset of cells in distal tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human renal cancer shows strong nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows moderate to strong nuclear positivity in a subset of lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes.
- Sample type
- HUMAN