H00202559-B01

KHDRBS2 antibody from Abnova Corporation
MGC26664, SLM-1, SLM1

Antibody data

Product number
H00202559-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00202559-B01, RRID:AB_1138478
Product name
KHDRBS2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00202559-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KHDRBS2 protein.
Antigen sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKF
QGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ
YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKG
SMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAP
PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLREL
SYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI
PPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTP
RARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEY
DDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYD
SYAPEEWATTSSSLKAPPQRSARGGYREHPYGRY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -