H00007799-A01

PRDM2 antibody from Abnova Corporation
HUMHOXY1, KMT8, KMT8A, MTB-ZF, RIZ, RIZ1, RIZ2
No application information provided.

Antibody data

Product number
H00007799-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007799-A01, RRID:AB_462235
Product name
PRDM2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00007799-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant PRDM2.
Antigen sequence
KTSRSLHVRVQKSKAVLQSKSTLASKKRTDRFNIK
SRERSGGPVTRSLQLAAAADLSENKREDGSAKQEL
KDFSYSLRLASRCSPPAAPYITRQYRKVKA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -