H00057798-A01

GATAD1 antibody from Abnova Corporation
FLJ22489, ODAG, RG083M05.2

Antibody data

Product number
H00057798-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057798-A01, RRID:AB_462545
Product name
GATAD1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00057798-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant GATAD1.
Antigen sequence
KQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKG
RRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQI
GDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALT
WLIP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -