ABIN1107337

GATAD1 antibody from antibodies-online
FLJ22489, ODAG, RG083M05.2

Antibody data

Product number
ABIN1107337
Provider
antibodies-online
Product name
anti-GATA Zinc Finger Domain Containing 1 (GATAD1) (C-Term) antibody
Provider product page
antibodies-online - ABIN1107337
Antibody type
Polyclonal
Antigen
The immunogen for anti-GATAD1 antibody: synthetic peptide directed towards the C terminal of human GATAD1.
Description
Purified using peptide immunoaffinity column
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYI
WTHVGPTPAITIKES
Epitope
C-Term
Vial size
50 μg
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -