AV33193

GATAD1 antibody from Sigma-Aldrich
FLJ22489, ODAG, RG083M05.2
No application information provided.

Antibody data

Product number
AV33193
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV33193, RRID:AB_1849520
Product name
Anti-GATAD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV33193
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GATAD1 with an internal ID of P04230
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIW
THVGPTPAITIKESV
Storage
-20C
Provider Type Product Number
- No reagents -