HPA024662

antibody from Atlas Antibodies

Targeting: TSPOAP1 BZRAP1, KIAA0612, PRAX-1, RIM-BP1, RIMBP1

Antibody data

Submit

Validation data

Product number: HPA024662 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA024662, RRID:AB_2066340
Product name: Anti-TSPOAP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTP PAALQLQELRSEESSKPKGDGSSRPVGGTDPEGAE ACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNM SFGD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TSPOAP1 protein structure - HPA024662 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, pancreas and rectum using Anti-TSPOAP1 antibody HPA024662 (A) shows similar protein distribution across tissues to independent antibody HPA025244 (B).
Antibody #2 product nr: HPA025244
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-TSPOAP1 antibody HPA024662.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube using Anti-TSPOAP1 antibody HPA024662.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TSPOAP1 antibody HPA024662.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum using Anti-TSPOAP1 antibody HPA024662.
Sample type: HUMAN