HPA024662

TSPOAP1 antibody from Atlas Antibodies
BZRAP1, KIAA0612, PRAX-1, RIM-BP1, RIMBP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024662
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024662, RRID:AB_2066340
Product name
Anti-TSPOAP1
Provider product page
Atlas Antibodies - HPA024662
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTP
PAALQLQELRSEESSKPKGDGSSRPVGGTDPEGAE
ACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNM
SFGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -