Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109006 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Short Stature Homeobox 2 (SHOX2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SHOX2 antibody: synthetic peptide directed towards the middle region of human SHOX2
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQF
EACRVAPYVNVGALR- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references SHOT, a SHOX-related homeobox gene, is implicated in craniofacial, brain, heart, and limb development.
Blaschke RJ, Monaghan AP, Schiller S, Schechinger B, Rao E, Padilla-Nash H, Ried T, Rappold GA
Proceedings of the National Academy of Sciences of the United States of America 1998 Mar 3;95(5):2406-11
Proceedings of the National Academy of Sciences of the United States of America 1998 Mar 3;95(5):2406-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate; SHOX2 antibody - middle region (AP42192PU-N) in Human Jurkat cells using Western Blot