Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183164 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNA7 antibody: synthetic peptide directed towards the C terminal of human KCNA7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELP
PPLWA PPGKHLVTEV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Haemophilus influenzae septic abortion.
Characterisation of the human voltage-gated potassium channel gene, KCNA7, a candidate gene for inherited cardiac disorders, and its exclusion as cause of progressive familial heart block I (PFHBI).
Cherpes TL, Kusne S, Hillier SL
Infectious diseases in obstetrics and gynecology 2002;10(3):161-4
Infectious diseases in obstetrics and gynecology 2002;10(3):161-4
Characterisation of the human voltage-gated potassium channel gene, KCNA7, a candidate gene for inherited cardiac disorders, and its exclusion as cause of progressive familial heart block I (PFHBI).
Bardien-Kruger S, Wulff H, Arieff Z, Brink P, Chandy KG, Corfield V
European journal of human genetics : EJHG 2002 Jan;10(1):36-43
European journal of human genetics : EJHG 2002 Jan;10(1):36-43
No comments: Submit comment
No validations: Submit validation data